cold chain is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2026-06-29. Numbers and descriptions here follow the published literature rather than marketing material.
Cold-chain practice relies on documented temperature ranges, calibrated monitoring, and minimized excursions. Shipments may use insulated boxes, phase-change materials, or dry ice, with data loggers to record conditions. Upon receipt, the recipient should verify the logger trace and place items into long-term storage promptly. Repeated warming and cooling during transfers can be more harmful than a single controlled excursion. For solutions, dividing material into single-use aliquots reduces the number of thawing and refreezing events and limits repeated opening of the same container.
Handling begins before a peptide arrives at the bench. Containers should be inspected for cracks, loose caps, or visible moisture, and labels should record identity, lot, and receipt date. Lyophilized material is often allowed to equilibrate to room temperature before opening to prevent condensation on the powder. Gloves and a clean workspace reduce contamination and static-related loss. Once opened, the vial may be purged with inert gas and resealed if the peptide is sensitive to oxygen or humidity. These steps are procedural safeguards rather than guarantees of stability.
Reconstitution introduces new risks because the peptide contacts solvent, air, and container surfaces. The chosen solvent should match the peptide's solubility profile, and buffer salts, pH, and ionic strength can affect dissolution and subsequent stability. Gentle mixing is preferred over vigorous vortexing, which can create interfaces and shear. If the solution is not clear, the cause may be incomplete dissolution, aggregation, or insoluble counter-ions rather than a simple concentration problem. Filtration is sometimes used, but filters can adsorb peptides and alter measured concentration.
Reconstitution introduces new variables. The solvent should match the peptide's solubility profile, and water or buffer quality matters because trace metals and microbes can alter results. Adding solvent gently down the vial wall minimizes foaming, which can denature some sequences. Mixing by gentle inversion or swirling is usually preferred over vigorous vortexing. If a peptide does not dissolve readily, adjusting pH or using a small amount of organic co-solvent may help, but such steps can also affect stability and should be documented.
Quality control links handling to measurable identity and purity. Reverse-phase high-performance liquid chromatography can separate peptide variants and reveal impurities. Mass spectrometry confirms molecular mass and can detect truncations or modifications. These methods are often paired with ultraviolet absorbance or amino acid analysis for concentration. Documentation of instrument settings, column type, and reference standards supports reproducibility. For research materials, acceptance criteria depend on the intended application, and no universal purity threshold applies to all peptides.
| Property | Value | Notes |
|---|---|---|
| Container material | Glass or polypropylene | Low-binding options reduce peptide adsorption |
| Typical shipping condition | Dry ice or gel packs | Choice depends on required temperature range |
| Light protection | Amber vial or foil wrap | Reduces photodegradation of sensitive residues |
| Reconstitution solvent | Water, buffer, or organic co-solvent | Depends on peptide solubility and assay requirements |
| Temperature monitoring | Data logger or indicator | Documents excursions during transport and storage |
Practical handling begins with an inventory record that links each vial to a lot number, synthesis date, and purity certificate. Before opening a container, allow it to equilibrate to room temperature to prevent condensation on the powder. Weighing or transferring should occur in a low-humidity environment using tools that minimize static and adsorption. Hygroscopic peptides may gain water quickly, changing mass and concentration estimates. Recording the container's initial mass and any visible changes supports later reconciliation of material.
Reconstitution introduces additional variables: solvent choice, pH, ionic strength, and filtration. Many sequences dissolve readily in water, while hydrophobic ones may need acetonitrile, dimethyl sulfoxide, or a small amount of base. Adding solvent slowly and avoiding vigorous vortexing can reduce foaming and shear-induced aggregation. If the solution appears cloudy, filtration may remove particulates but can also remove aggregated peptide and alter concentration. A clear solution does not by itself confirm correct sequence or purity, so analytical checks remain necessary.
Reconstitution solvent depends on peptide solubility and intended use; water, buffer, or small amounts of organic solvent may be needed. After dissolution, solutions are typically aliquoted into single-use portions to avoid repeated freeze-thaw cycles. Aliquots are stored at -20 °C or -80 °C, depending on stability. Labels include concentration, solvent, date, and operator. Sterile filtration may be used when microbial control is required, but filters can adsorb peptides. The optimal concentration and solvent are often determined empirically.
Cold-chain shipping uses insulated containers, phase-change packs, and temperature indicators. Dry ice maintains -70 °C or lower but requires venting to avoid pressure buildup. Gel packs provide 2-8 °C for shorter transit. Upon arrival, recipients should record temperature indicators and transfer vials promptly to storage. Deviations from specified conditions should be documented and may require analytical re-check. The effect of a brief temperature excursion is peptide-specific and not always predictable from general rules.
Handling begins with receipt and inspection. Vials should be checked for damage, label integrity, and temperature history. Lyophilized peptides should be allowed to equilibrate to room temperature before opening to prevent condensation. Solutions should be prepared in a clean, calibrated environment using appropriate solvents. Personal protective equipment and containment reduce exposure and contamination. Documentation of lot number, date, and storage location supports traceability. The goal is to limit repeated temperature changes, moisture exposure, and microbial contamination.
The citric acid cycle is regulated mainly by the availability of key substrates, particularly the ratio of NAD+ to NADH and the concentrations of calcium, inorganic phosphate, ATP, ADP, and AMP. Citrate – the ion that gives its name to the cycle – is a feedback inhibitor of citrate synthase and also inhibits PFK, providing a direct link between the regulation of the citric acid cycle and glycolysis.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
The only drug currently approved for stroke treatment is tPA, which can cause dangerous brain bleeding. In 2005, Griffin et al proposed using Activated Protein C in conjunction with tPA to protect the brain from tPA’s harmful side-effects. APC activates protease-activated receptor 1 (PAR-1), which plays a role in the interaction of coagulation and inflammation. The 3K3A-APC was designed to have more activity at protease-activated receptor 1 (PAR-1) and less anticoagulative effect than activated protein C. The phase 2 trial, RHAPSODY, was performed in the lab of Berislav Zlokovic, the scientific founder of ZZ Biotech, to determine safety and tolerability of the drug. A phase 3 $30 million trial, RHAPSODY-2, was planned to determine safety and efficacy for treatment of ischemic stroke. However, on November 16, 2023, the National Institutes of Health (NIH) paused the start of the human trial of 3K3A-APC after an investigation by Science Magazine.
The use of high-resolution ion-mobility mass spectrometry (IMS-MS) on HPLC-purified alpha-synuclein in vitro has shown alpha-synuclein to be autoproteolytic (self-proteolytic), generating a variety of small molecular weight fragments upon incubation. The 14.46 kDa protein was found to generate numerous smaller fragments, including 12.16 kDa (amino acids 14–133) and 10.44 kDa (40–140) fragments formed through C- and N-terminal truncation and a 7.27 kDa C-terminal fragment (72–140). The 7.27 kDa fragment, which contains the majority of the NAC region, aggregated considerably faster than full-length alpha-synuclein. It is possible that these autoproteolytic products play a role as intermediates or cofactors in the aggregation of alpha-synuclein in vivo.
Sources: en.wikipedia.org
Righthanded β-helices, typified by the pectate lyase enzyme shown at left or P22 phage tailspike protein, have a less regular cross-section, longer and indented on one of the sides; of the three linker loops, one is consistently just two residues long and the others are variable, often elaborated to form a binding or active site. A two-sided β-helix (right-handed) is found in some bacterial metalloproteases; its two loops are each six residues long and bind stabilizing calcium ions to maintain the integrity of the structure, using the backbone and the Asp side chain oxygens of a GGXGXD sequence motif. This fold is called a β-roll in the SCOP classification.
The 2014 Ebola outbreak killed more than 11,300 people. In the Democratic Republic of Congo (DRC), as of January 2020, this is the second largest outbreak with over 3,400 confirmed or probable cases, including more than 2,200 deaths. Regeneron used its VelociGene, VelocImmune, and VelociMab antibody discovery and production technologies and coordinated with the U.S. government's Biomedical Advanced Research and Development Authority (BARDA). The therapy was developed in 6 months and a Phase 1 trial in healthy humans was completed in 2015.
Donald has supervised many students and postdocs, many of whom are now professors in reputed universities such as MIT, Carnegie-Mellon University, University of Washington, Seattle, University of Massachusetts Amherst, Dartmouth College, Duke University, Middlebury College and University of Toronto, and researchers at organizations such as NIAID, NIST, IBM, Sandia National Laboratories. Donald is the son of historian David Herbert Donald and historian and editor Aida DiPace Donald. MEMS Protein design NMR Protein Structure Kinodynamic planning Donald is the author of over 100 publications. A representative selection includes:
Sources: en.wikipedia.org
Adrenocorticotropic hormone (ACTH; also adrenocorticotropin, corticotropin) is a polypeptide tropic hormone produced by and secreted by the anterior pituitary gland. It is also used as a medication and diagnostic agent. ACTH is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of cortisol and androgens by the zona fasciculata and zona reticularis, respectively. ACTH is also related to the circadian rhythm in many organisms. Deficiency of ACTH is an indicator of secondary adrenal insufficiency (suppressed production of ACTH due to an impairment of the pituitary gland or hypothalamus, cf. hypopituitarism) or tertiary adrenal insufficiency (disease of the hypothalamus, with a decrease in the release of corticotropin releasing hormone (CRH)). Conversely, chronically elevated ACTH levels occur in primary adrenal insufficiency (e.g. Addison's disease) when adrenal gland production of cortisol is chronically deficient. In Cushing's disease, a pituitary tumor leads to excessive production of ACTH, which stimulates the adrenal cortex to produce high levels of cortisol.
Cervical drug delivery serves as a route for compounds to prevent and treat sexually transmitted diseases (STDs). Prevention of STDs for women can be achieved by administering preventative compounds into the vaginal canal prior to intercourse. One method researched is the use of a CAP technology that remains stable in the vaginal environment, but breaks down in the presence of human semen, releasing a drug to destroy STDs. This application of cervical drug delivery would be useful for prevention of STDs in women without interfering with the bodily environment until there is potential for infection. STDs can also be treated through cervical drug delivery methods. Antibiotics for STD treatment are often administered into the vagina in the form of creams or gels.
The Green Chemistry Institute (GCI) supports the "implementation of green chemistry and engineering throughout the global chemistry enterprise." The GCI organizes an annual conference, the Green Chemistry and Engineering Conference, provides research grants, administers awards, and provides information and support for green chemistry practices to educators, researchers, and industry. The GCI was founded in 1997 as an independent non-profit organization, by chemists Joe Breen and Dennis Hjeresen in cooperation with the Environmental Protection Agency. In 2001, the GCI became a part of the American Chemical Society.[1]
AS9100 Revision A (2001), Model for Quality Assurance in Design, Development, Production, Installation and Servicing During the rewrite of ISO 9001 for the 2000 release, the AS group worked closely with the ISO organization. As the year 2000 revision of ISO 9001 incorporated major organizational and philosophical changes, AS9000 underwent a rewrite as well. It was released as AS9100 to the international aerospace industry at the same time as the new version of ISO 9001. AS9100A was actually two standards referenced in one publication: Section 1 defines an updated QMS model aligned with the updated ISO 9001:2000 publication while Section 2 defines a legacy model aligned with ISO 9001:1994. Organizations that in the year 2001 were operating a QMS based on ISO 9001:1994 were permitted to conform to Section 2 with the expectation that they would then transition their QMS to Section 1.
Sources: en.wikipedia.org
Allow the sealed vial to reach room temperature before opening to reduce condensation. Use a suitable solvent and gentle mixing rather than vigorous agitation. Follow the supplier's solubility information when available.
Aliquots limit repeated thawing and refreezing and repeated vial opening, both of which can promote degradation. They also reduce the chance of contaminating an entire batch. Single-use portions should be labeled with identity, concentration, solvent, and date.
Inspect the package for damage and confirm that temperature indicators or data loggers stayed within the specified range. Check the vial condition and labeling before placing it into storage. Record any excursion or discrepancy for the supplier or quality system.
Aliquoting divides a stock into portions that can be thawed once and used without returning the whole batch to storage. This limits temperature cycling and reduces the chance of contamination or concentration changes. It also makes it easier to track how many portions remain.